LL37
- USA 2-Day Shipping Tracked, insured
- 99%+ Purity HPLC verified
- 6-Panel COA Independent lab
- Verified Researcher Access Attestation gated
$120.00
LL-37 is the 37-amino-acid human cathelicidin antimicrobial peptide, generated by proteolytic processing of the hCAP-18 precursor, supplied as a high-purity lyophilized powder.
☆☆☆☆☆ Be the first to reviewIn stock
Storage Instructions
All products from Vitae Peptides are manufactured using a lyophilization (freeze-drying) process. This method is designed to maintain product integrity and allows vials to remain stable during shipping for approximately 3–4 months.
Once a vial is reconstituted with bacteriostatic water, it should be stored in the refrigerator to help maintain stability. Under these conditions, reconstituted material is generally considered stable for up to 30 days.
Lyophilization is a dehydration technique in which compounds are frozen and then exposed to low pressure. This causes the water in the vial to sublimate directly from solid to gas, leaving behind a stable, crystalline white structure. This powder can be kept at room temperature until reconstitution.
Upon receipt, products should be stored away from heat and light. For short-term use, refrigeration at approximately 4°C (39°F) is suitable. For long-term storage (several months to years), vials may be placed in a freezer at approximately -80°C (-112°F). Freezing is the preferred method for preserving product stability over extended periods.
⚠️ Important Notice:
These products are intended for research use only. Not for human consumption.
Product details
| Amino acid sequence | [LL-37, 37 aa] |
|---|---|
| Vial size | 5mg lyophilized powder |
| Purity standard | 99%+ HPLC-verified |
Mechanism of action
In in vitro and preclinical studies, LL-37 is used to investigate mechanisms of antimicrobial membrane disruption, innate-immune signaling, neutrophil and mast-cell chemotaxis, and tissue-repair pathways. Research has characterized the peptide's amphipathic α-helical conformation on contact with microbial membranes (carpet- and toroidal-pore disruption) and its binding to FPRL1/FPR2 receptors on immune cells.
Storage & handling
Lyophilized powder vial intended for research use — this is not a capsule or oral supplement. Store the unreconstituted vial at -20°C in a dry, light-protected environment for long-term stability. Once reconstituted with bacteriostatic water, refrigerate at 2-8°C and use within 30 days. Do not freeze reconstituted solution.
Reviews & Ratings
Reviews are not yet open for this product.
Certificate of Analysis
Each size is verified by an independent third-party laboratory. Select a size below to view its Certificate of Analysis.
Frequently asked questions
Why Vitae Peptides?
Guaranteed 99%+ pure, always third-party tested. Every batch is verified by HPLC-UV/MS at an independent US laboratory, with full Certificate of Analysis documentation. US-based, US-only shipping, and a 30-day satisfaction guarantee on every order.
Do you test your products and provide COAs?
Yes — every batch. We publish HPLC, heavy-metals, and endotoxin Certificates of Analysis in our lab reports library, and embed them on each product page when batch-specific reports are available.
What is your shipping policy?
US-only shipping, sent same business day on orders placed before 2pm ET. Free shipping on orders over $99; otherwise flat $9.95. USPS Ground Advantage and UPS Ground both available at live rates.
How should I store my peptides?
Lyophilized (unreconstituted) powder: store at -20°C in a dry, light-protected environment for long-term stability. Once reconstituted with bacteriostatic water, refrigerate at 2-8°C and use within 30 days. Do not freeze reconstituted solution. See the Storage & handling accordion above for product-specific guidance.
What is your refund / replacement policy?
Defective or damaged products are replaced or refunded within 30 days of delivery — our satisfaction guarantee. Products are sold strictly for research and laboratory use only; we do not accept returns for change of mind. See our full Terms & Conditions.
All products on this site are sold for research, laboratory, or analytical use only, and are not for human consumption, medical, diagnostic, cosmetic, veterinary, or any other non-research application. The statements on this website have not been evaluated by the U.S. Food and Drug Administration. The products and information provided by Vitae Peptides are not intended to diagnose, treat, cure, or prevent any disease. Vitae Peptides is a research chemical supplier; we are not a compounding pharmacy or compounding facility as defined under Section 503A of the Federal Food, Drug, and Cosmetic Act, nor are we an outsourcing facility as defined under Section 503B.





